PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007463-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 474aa    MW: 53194.3 Da    PI: 6.3077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007463-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-18144190148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd llv++vkq+G + W++Ia+++  gR +kqc++rw+++l
    NNU_007463-RA 144 KGQWTDEEDRLLVRLVKQYGVKKWALIAQKLV-GRAGKQCRERWHNHL 190
                      799*****************************.*************97 PP

2Myb_DNA-binding57.43.4e-18196238145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eE++llv+a+++ G++ W+ Ia++++ gRt++ +k++w+
    NNU_007463-RA 196 KDTWSEEEEKLLVEAHEKIGNK-WAEIAKRIP-GRTENAIKNHWN 238
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.706139194IPR017930Myb domain
SuperFamilySSF466898.63E-31141237IPR009057Homeodomain-like
SMARTSM007172.3E-17143192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-27145198IPR009057Homeodomain-like
PfamPF139217.1E-20147207No hitNo description
CDDcd001676.92E-16147190No hitNo description
SMARTSM007171.1E-16195243IPR001005SANT/Myb domain
PROSITE profilePS5129420.56195245IPR017930Myb domain
CDDcd001673.15E-13198241No hitNo description
Gene3DG3DSA:1.10.10.601.0E-20199243IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MEGGGFGYGL LEKKPHSLRP LPPLTAIDRF LWSPSDLFPK HTEINKIKRD TVISANGFRS  60
FSSPSPSGGG ARAADDGYSS GVLLPSSTQD MSFIDGLFAE GDSVNYRPDR NRSEGVREEM  120
KLGEKNATCM GKRVKGGSSA NLIKGQWTDE EDRLLVRLVK QYGVKKWALI AQKLVGRAGK  180
QCRERWHNHL RPDIKKDTWS EEEEKLLVEA HEKIGNKWAE IAKRIPGRTE NAIKNHWNAT  240
KRRQNSRRKI NKAANQGEKS QSSILQEYIR RKSMKENSTI VNPSLLTSST LSTNPSRQFN  300
AVTLPDPPSS DHSTPRDDSA RSYDEELLFI TEFLESIYQQ PSDYSTVVVS TEGDTFDGWN  360
LQKHMSSDDE LLPFAETDEC GFSASTVPIT NMHHNVDDIP REVTNPSSHL YSDVYIACLL  420
NGSTPSSSTS DQNYFSDNPE IDLLMDMEQS CLNVKKEMDL IEMVSSSRFS QSNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-451422442104C-Myb DNA-Binding Domain
1mse_C2e-451422442104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257103.10.0PREDICTED: transcription factor TT2-like
TrEMBLB9SHZ41e-113B9SHZ4_RICCO; Myb119, putative
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.13e-64myb domain protein 119